CacheBy
Atlas Antibodies Anti-MAB21L3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAB21L3 Antibody

상품 한눈에 보기

Human MAB21L3 단백질을 인식하는 Rabbit Polyclonal 항체. ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 마우스 및 랫트와 높은 상동성을 가짐. 40% 글리세롤/PBS 완충용액에 보존.

카탈로그번호
HPA046187-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046187-100 Anti-MAB21L3 Antibody, mab-21-like 3 (C. elegans) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046187-25 Anti-MAB21L3 Antibody, mab-21-like 3 (C. elegans) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAB21L3 Antibody

Anti-MAB21L3 Antibody

Product Description

Polyclonal antibody against Human MAB21L3 (mab-21-like 3, C. elegans).

  • ICC (Immunocytochemistry)

Alternative Gene Names

  • C1orf161
  • FLJ38716

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein mab-21-like 3 (C. elegans)
Target Gene MAB21L3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
TWSKKARWPRCLQRWPSQERVECIKSFGFNLLACSNYHWQLSFLRAEQVLLEQLDEDGGCRRKCFQVMRHLKEDIWCPGNRPV

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000044313 81%
Rat ENSRNOG00000016044 80%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.