CacheBy
Atlas Antibodies Anti-LYSMD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LYSMD1 Antibody

상품 한눈에 보기

인간 LYSMD1 단백질을 인식하는 고품질 폴리클로날 항체. IHC, WB(재조합 발현 검증), ICC 등 다양한 응용에 적합. 토끼 유래 IgG로 제작되었으며, PrEST 항원으로 친화 정제. 인간에 대한 높은 특이성과 재현성 제공.

카탈로그번호
HPA064537-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064537-100 Anti-LYSMD1 Antibody, LysM, putative peptidoglycan-binding, domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064537-25 Anti-LYSMD1 Antibody, LysM, putative peptidoglycan-binding, domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LYSMD1 Antibody

Anti-LYSMD1 Antibody

Target: LysM, putative peptidoglycan-binding, domain containing 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human LYSMD1


Alternative Gene Names

MGC35223, RP11-68I18.5, SB145

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein LysM, putative peptidoglycan-binding, domain containing 1
Target Gene LYSMD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGENGVPGEDAGLHLSSPWMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000094935): 88%
  • Rat (ENSRNOG00000021099): 88%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.