CacheBy
Atlas Antibodies Anti-LYPD6 Antibody
원본

Atlas Antibodies Anti-LYPD6 Antibody

상품 한눈에 보기

Human LYPD6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 높은 종간 보존성을 보입니다. PBS/glycerol buffer에 보존제로 sodium azide를 포함합니다.

카탈로그번호
HPA042805-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042805-100 Anti-LYPD6 Antibody, LY6/PLAUR domain containing 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042805-25 Anti-LYPD6 Antibody, LY6/PLAUR domain containing 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LYPD6 Antibody

Anti-LYPD6 Antibody

Target: LY6/PLAUR domain containing 6
Type: Polyclonal Antibody against Human LYPD6


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human LYPD6 (LY6/PLAUR domain containing 6).


Alternative Gene Names

  • MGC52057

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein LY6/PLAUR domain containing 6
Target Gene LYPD6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPL
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000038980 (99%), Mouse ENSMUSG00000050447 (99%)

Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.