
원본
Atlas Antibodies Anti-LYPD6 Antibody
상품 한눈에 보기
Human LYPD6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 높은 종간 보존성을 보입니다. PBS/glycerol buffer에 보존제로 sodium azide를 포함합니다.
- 카탈로그번호
- HPA042805-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042805-100 Anti-LYPD6 Antibody, LY6/PLAUR domain containing 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042805-25 Anti-LYPD6 Antibody, LY6/PLAUR domain containing 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LYPD6 Antibody
Anti-LYPD6 Antibody
Target: LY6/PLAUR domain containing 6
Type: Polyclonal Antibody against Human LYPD6
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human LYPD6 (LY6/PLAUR domain containing 6).
Alternative Gene Names
- MGC52057
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | LY6/PLAUR domain containing 6 |
| Target Gene | LYPD6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000038980 (99%), Mouse ENSMUSG00000050447 (99%) |
Antibody Information
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



