CacheBy
Atlas Antibodies Anti-LYAR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LYAR Antibody

상품 한눈에 보기

Human LYAR 단백질을 인식하는 토끼 폴리클로날 항체로, WB 등 연구용에 적합. Affinity purification으로 높은 특이성과 신뢰성 확보. PrEST 항원 기반으로 제작되어 재현성 우수. 40% glycerol buffer로 장기 보존 가능.

카탈로그번호
HPA035880-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035880-100 Anti-LYAR Antibody, Ly1 antibody reactive 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035880-25 Anti-LYAR Antibody, Ly1 antibody reactive 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LYAR Antibody

Anti-LYAR Antibody

Human LYAR 단백질에 대한 토끼 폴리클로날 항체입니다. Western blot 등 다양한 응용에 적합합니다.

  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human LYAR

Alternative Gene Names

  • ZC2HC2
  • ZLYAR

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Ly1 antibody reactive
Target Gene LYAR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000005374 (94%), Mouse ENSMUSG00000067367 (92%)

Antigen Sequence (PrEST):
ACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYEGKTHKGDIKQQAWIQKISELIKRPNVSPKV

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자 실험 환경에 따라 결정되어야 합니다.

제품 이미지

Recommended Applications - WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.