CacheBy
Atlas Antibodies Anti-LUZP6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LUZP6 Antibody

상품 한눈에 보기

Human LUZP6 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 Affinity Purified. Human에 대한 반응성이 검증됨. 40% glycerol/PBS buffer에 보존됨.

카탈로그번호
HPA077907-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077907-100 Anti-LUZP6 Antibody, leucine zipper protein 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077907-25 Anti-LUZP6 Antibody, leucine zipper protein 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LUZP6 Antibody

Anti-LUZP6 Antibody

Target Protein: leucine zipper protein 6 (LUZP6)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human LUZP6.


Alternative Gene Names

  • MPD6
  • MTPNUT

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein leucine zipper protein 6
Target Gene LUZP6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000059206 (30%), Rat ENSRNOG00000003131 (28%)

Antigen Sequence:
VISYALYQVQTGSLPVYSSVLTKSPLQLQTVIYRLIVQIQHLNIPSSSSTHSS


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.