CacheBy
Atlas Antibodies Anti-LUZP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LUZP1 Antibody

상품 한눈에 보기

인간 LUZP1 단백질을 인식하는 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 정제됨. Human에 대해 검증된 반응성을 가지며, 높은 종간 서열 유사성을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028542-100 Anti-LUZP1 Antibody, leucine zipper protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028542-25 Anti-LUZP1 Antibody, leucine zipper protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LUZP1 Antibody

Anti-LUZP1 Antibody

Target Information

  • Target Protein: Leucine zipper protein 1
  • Target Gene: LUZP1
  • Alternative Gene Names: LUZP

Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human LUZP1.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

RERHTSTSNIQVGLAELTSVSNHVSSPFELSIHKHDITLQLAEAERMADGPLKNRPETVVSRSSIIIKPSDPVERNSHAPPAETIRWKSH

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000022402): 86%
  • Mouse (ENSMUSG00000001089): 81%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.