
Thermo Fisher Scientific Human CCL25 (TECK) Recombinant Protein, PeproTech
인간 유래 CCL25(TECK) 재조합 단백질로, CCR9 수용체 결합 활성 검증됨. E. coli 발현 시스템에서 생산되며, 순도 98% 이상. Western blot, ELISA, 기능적 분석 등 다양한 실험에 사용 가능. 동결건조 형태로 제공되며 -20°C에서 보관.
- 카탈로그번호
- 300-45-xxx (7개 옵션)
- 카테고리
- Protein
- 판매단위
- pk
카탈로그
7개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Human CCL25 (TECK) Recombinant Protein, PeproTech
Applications
Western Blot (WB)
- Tested Dilution: Assay-dependent
ELISA
- Tested Dilution: Assay-dependent
Functional Assay
- Tested Dilution: Assay-dependent
In vitro Assay
- Tested Dilution: Not specified
- Publications: 22 references available
Miscellaneous PubMed
- Publications: 4 references available
Product Specifications
| 항목 | 내용 |
|---|---|
| Species | Human |
| Published Species | Bacteria, Hamster, Human, Mouse, Pig |
| Expression System | E. coli |
| Amino Acid Sequence | QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNMQTFQAGPHA V KKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL |
| Molecular Weight | 14.2 kDa |
| Class | Recombinant |
| Type | Protein |
| Purity | ≥ 98% by SDS-PAGE gel and HPLC analyses |
| Endotoxin Concentration | < 1 EU/µg |
| Activity | Binds CCR9 receptor on MOLT4 cells |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Purification | Purified |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient |
Product Specific Information
Recombinant Human TECK은 127개의 아미노산 잔기로 구성된 14.2 kDa 단백질로, CC 케모카인에 존재하는 4개의 보존된 시스테인 잔기를 포함합니다.
본 제품은 상온에서 배송되며, 보관, 취급 및 재구성에 대한 자세한 정보는 로트별 분석 인증서(Certificate of Analysis)를 참조하십시오.
Target Information
Chemokines는 흉선 내에서 발달 중인 T 세포의 이동을 조절하는 데 중요한 역할을 합니다.
C-C thymus expressed chemokine (TECK, CCL25)는 주로 흉선 수지상세포, 흉선 상피세포, 소장에서 발현되며, CCR9의 리간드로 작용합니다.
TECK은 여러 성장 인자에 의해 증식이 유도된 미성숙 골수 전구세포 아형에 대해 억제 활성을 나타내며, CCR9을 통해 신호를 전달하여 흉선세포 발달 단계에서의 이동에 관여합니다.
또한, 골수의 pre-pro-B 세포 및 IL-7과 Flt-3 ligand 존재 하에서 pro-B 콜로니를 생성할 수 있는 세포는 TECK에 반응하여 이동하지만, 이후 단계의 B 세포에서는 이러한 반응이 사라집니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
