CacheBy
Atlas Antibodies Anti-ANKDD1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ANKDD1A Antibody

상품 한눈에 보기

Human ANKDD1A 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC 및 ICC 실험에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. Human에 검증된 반응성을 보유.

카탈로그번호
HPA040757-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040757-100 Anti-ANKDD1A Antibody, ankyrin repeat and death domain containing 1A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040757-25 Anti-ANKDD1A Antibody, ankyrin repeat and death domain containing 1A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ANKDD1A Antibody

Anti-ANKDD1A Antibody

Target: ankyrin repeat and death domain containing 1A
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human ANKDD1A


Alternative Gene Names

  • FLJ25870

Open Datasheet


Target Information

항목 내용
Target Protein ankyrin repeat and death domain containing 1A
Target Gene ANKDD1A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000066510 (73%), Rat ENSRNOG00000015554 (66%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

LTALHSAAGGSHPDCVQLLLRAGSTVNALTQKNLSCLHYAALSGSEDVSRVLIHAGGCANVVDHQGASPLHLAVRHNFPALVRLLINSDSDVNAV

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.