CacheBy
Atlas Antibodies Anti-ANAPC4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ANAPC4 Antibody

상품 한눈에 보기

Human ANAPC4 단백질을 인식하는 Rabbit Polyclonal 항체로, anaphase promoting complex subunit 4 검출에 적합. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원으로 친화 정제됨. Human에 대해 검증 완료.

카탈로그번호
HPA038395-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038395-100 Anti-ANAPC4 Antibody, anaphase promoting complex subunit 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038395-25 Anti-ANAPC4 Antibody, anaphase promoting complex subunit 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ANAPC4 Antibody

Anti-ANAPC4 Antibody

Target: anaphase promoting complex subunit 4 (ANAPC4)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human ANAPC4.


Alternative Gene Names

  • APC4

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein anaphase promoting complex subunit 4
Target Gene ANAPC4
Verified Species Reactivity Human
Interspecies Identity Rat (89%), Mouse (87%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:

VTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHV

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer PBS (pH 7.2)
Glycerol 40%
Preservative 0.02% Sodium azide (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Application: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.