CacheBy
Atlas Antibodies Anti-ANAPC15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ANAPC15 Antibody

상품 한눈에 보기

Human ANAPC15 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. PrEST 항원으로 친화 정제되었으며, 재조합 발현 검증을 거쳤습니다. 40% 글리세롤 및 PBS 버퍼에 보존되어 있습니다.

카탈로그번호
HPA036596-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036596-100 Anti-ANAPC15 Antibody, anaphase promoting complex subunit 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036596-25 Anti-ANAPC15 Antibody, anaphase promoting complex subunit 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ANAPC15 Antibody

Anti-ANAPC15 Antibody

anaphase promoting complex subunit 15


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)
    • Recombinant expression validation in WB using target protein overexpression.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human ANAPC15


Alternative Gene Names

APC15, C11orf51, DKFZP564M082, HSPC020

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein anaphase promoting complex subunit 15
Target Gene ANAPC15
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
PSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEED
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000019936 (100%)
Mouse ENSMUSG00000030649 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.