CacheBy
Atlas Antibodies Anti-ALOXE3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALOXE3 Antibody

상품 한눈에 보기

인간 ALOXE3 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합합니다. Orthogonal 검증을 통해 RNA-seq 데이터와 비교하여 신뢰성 높은 결과를 제공합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다.

카탈로그번호
HPA078597-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA078597-100 Anti-ALOXE3 Antibody, arachidonate lipoxygenase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA078597-25 Anti-ALOXE3 Antibody, arachidonate lipoxygenase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALOXE3 Antibody

Anti-ALOXE3 Antibody

Target Protein: arachidonate lipoxygenase 3
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human ALOXE3 (arachidonate lipoxygenase 3).


Alternative Gene Names

E-LOX, eLOX3


Target Information

항목 내용
Target Protein arachidonate lipoxygenase 3
Target Gene ALOXE3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence YQWIEGYCTVELRPGTARTICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALTKTTTCVDQGDSS
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000007454 (86%), Mouse ENSMUSG00000020892 (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.