
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ALOXE3 Antibody
상품 한눈에 보기
인간 ALOXE3 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합합니다. Orthogonal 검증을 통해 RNA-seq 데이터와 비교하여 신뢰성 높은 결과를 제공합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다.
- 카탈로그번호
- HPA078597-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA078597-100 Anti-ALOXE3 Antibody, arachidonate lipoxygenase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA078597-25 Anti-ALOXE3 Antibody, arachidonate lipoxygenase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ALOXE3 Antibody
Anti-ALOXE3 Antibody
Target Protein: arachidonate lipoxygenase 3
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human ALOXE3 (arachidonate lipoxygenase 3).
Alternative Gene Names
E-LOX, eLOX3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | arachidonate lipoxygenase 3 |
| Target Gene | ALOXE3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | YQWIEGYCTVELRPGTARTICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALTKTTTCVDQGDSS |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000007454 (86%), Mouse ENSMUSG00000020892 (86%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Related Document
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



