CacheBy
Atlas Antibodies Anti-ALPK1 Antibody
원본

Atlas Antibodies Anti-ALPK1 Antibody

상품 한눈에 보기

Human ALPK1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증된 고품질 연구용 항체입니다.

카탈로그번호
HPA027435-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027435-100 Anti-ALPK1 Antibody, alpha-kinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027435-25 Anti-ALPK1 Antibody, alpha-kinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALPK1 Antibody

Anti-ALPK1 Antibody

Target Information

  • Target Protein: alpha-kinase 1
  • Target Gene: ALPK1
  • Alternative Gene Names: FLJ22670, KIAA1527, Lak

Product Description

Polyclonal antibody against human ALPK1.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTGKQELHSFVKAAFGLTTVHRRLHGETGTVHAASQLCKEAMGKLYNFSTSSRSQDREALSQEV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000028028 77%
Rat ENSRNOG00000022636 72%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet (MSDS)
Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.