CacheBy
Atlas Antibodies Anti-ALOX12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALOX12 Antibody

상품 한눈에 보기

Human ALOX12 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 특이성과 재현성을 제공합니다. 40% 글리세롤/PBS 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010691-100 Anti-ALOX12 Antibody, arachidonate 12-lipoxygenase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010691-25 Anti-ALOX12 Antibody, arachidonate 12-lipoxygenase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALOX12 Antibody

Anti-ALOX12 Antibody

Target: arachidonate 12-lipoxygenase (ALOX12)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ALOX12.


Alternative Gene Names

  • 12S-LOX

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein arachidonate 12-lipoxygenase
Target Gene ALOX12
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence YAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEY
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000000320 (80%), Rat ENSRNOG00000027037 (79%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.