CacheBy
Atlas Antibodies Anti-ALG3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALG3 Antibody

상품 한눈에 보기

Human ALG3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며 PrEST 항원으로 친화 정제됨. 높은 종간 반응성(인간, Rat, Mouse) 확인. 안정적인 PBS/glycerol 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA045103-100 Anti-ALG3 Antibody, ALG3, alpha-1,3- mannosyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045103-25 Anti-ALG3 Antibody, ALG3, alpha-1,3- mannosyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALG3 Antibody

Anti-ALG3 Antibody

Target: ALG3, alpha-1,3-mannosyltransferase
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 응용에 적합


Product Description

Polyclonal Antibody against Human ALG3


Alternative Gene Names

  • CDGS4
  • D16Ertd36e
  • Not56
  • NOT56L

Open Datasheet (PDF)


Target Information

  • Target Protein: ALG3, alpha-1,3-mannosyltransferase
  • Target Gene: ALG3

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000001712 89%
Mouse ENSMUSG00000033809 87%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.