CacheBy
Atlas Antibodies Anti-ALG13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALG13 Antibody

상품 한눈에 보기

인간 ALG13 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원으로 특이적 정제되었으며, 높은 종간 서열 일치도를 보입니다. 안정적인 PBS/glycerol 버퍼에 보존제로 sodium azide를 포함합니다.

카탈로그번호
HPA002853-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA002853-100 Anti-ALG13 Antibody, ALG13, UDP-N-acetylglucosaminyltransferase subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002853-25 Anti-ALG13 Antibody, ALG13, UDP-N-acetylglucosaminyltransferase subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALG13 Antibody

Anti-ALG13 Antibody

Target Protein: ALG13, UDP-N-acetylglucosaminyltransferase subunit
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ALG13.

Alternative Gene Names

CXorf45, FLJ23018, GLT28D1, MDS031, TDRD13, YGL047W

Open Datasheet

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

VGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPG

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000031286 88%
Rat ENSRNOG00000005753 87%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.