CacheBy
Atlas Antibodies Anti-ALDH7A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALDH7A1 Antibody

상품 한눈에 보기

Human ALDH7A1 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며, RNA-seq 데이터 기반 정교한 Orthogonal Validation 제공. 친화 정제된 고품질 항체로 안정한 PBS/glycerol buffer에 보관.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023296-100 Anti-ALDH7A1 Antibody, aldehyde dehydrogenase 7 family, member A1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023296-25 Anti-ALDH7A1 Antibody, aldehyde dehydrogenase 7 family, member A1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALDH7A1 Antibody

Anti-ALDH7A1 Antibody

Target: aldehyde dehydrogenase 7 family, member A1 (ALDH7A1)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human ALDH7A1


Alternative Gene Names

ATQ1, EPD, PDE


Target Information

항목 내용
Target Protein aldehyde dehydrogenase 7 family, member A1
Target Gene ALDH7A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILY
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000014645 (89%), Mouse ENSMUSG00000053644 (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.