CacheBy
Atlas Antibodies Anti-ALDH6A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALDH6A1 Antibody

상품 한눈에 보기

인간 ALDH6A1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 토끼 유래 IgG이며 PrEST 항원을 이용해 친화 정제되었습니다. 인간, 마우스, 랫트 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029073-100 Anti-ALDH6A1 Antibody, aldehyde dehydrogenase 6 family, member A1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029073-25 Anti-ALDH6A1 Antibody, aldehyde dehydrogenase 6 family, member A1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALDH6A1 Antibody

Anti-ALDH6A1 Antibody

Target: aldehyde dehydrogenase 6 family, member A1 (ALDH6A1)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against human ALDH6A1.


Alternative Gene Names

  • MMSDH

Target Information

항목 내용
Target Protein aldehyde dehydrogenase 6 family, member A1
Target Gene ALDH6A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIAKLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSIT

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000021238 96%
Rat ENSRNOG00000011419 95%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.