CacheBy
Atlas Antibodies Anti-ALDH3A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALDH3A1 Antibody

상품 한눈에 보기

인간 ALDH3A1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 분석에 적합. RNA-seq 데이터 기반 정교한 Orthogonal 검증 수행. PrEST 항원으로 친화 정제된 고품질 항체. 인체 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063783-100 Anti-ALDH3A1 Antibody, aldehyde dehydrogenase 3 family, member A1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063783-25 Anti-ALDH3A1 Antibody, aldehyde dehydrogenase 3 family, member A1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALDH3A1 Antibody

Anti-ALDH3A1 Antibody

Target: aldehyde dehydrogenase 3 family, member A1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry): Suitable for cellular localization studies.

Product Description

Polyclonal Antibody against Human ALDH3A1

Alternative Gene Names: ALDH3
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein aldehyde dehydrogenase 3 family, member A1
Target Gene ALDH3A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (81%), Rat (79%)

Antigen Sequence:
NSGMGSYHGKKSFETFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.