CacheBy
Atlas Antibodies Anti-ALDH1L1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALDH1L1 Antibody

상품 한눈에 보기

인간 ALDH1L1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. 독립 항체 검증으로 신뢰성 확보. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA050139-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050139-100 Anti-ALDH1L1 Antibody, aldehyde dehydrogenase 1 family, member L1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050139-25 Anti-ALDH1L1 Antibody, aldehyde dehydrogenase 1 family, member L1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALDH1L1 Antibody

Anti-ALDH1L1 Antibody

Target: aldehyde dehydrogenase 1 family, member L1
Supplier: Atlas Antibodies


  • IHC (Independent antibody validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human ALDH1L1.


Alternative Gene Names

10-fTHF, FTHFD

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein aldehyde dehydrogenase 1 family, member L1
Target Gene ALDH1L1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ILFGNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDF
Verified Species Reactivity Human
Interspecies Information Rat (84%, ENSRNOG00000047023), Mouse (83%, ENSMUSG00000030088)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.