
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AKR1B10 Antibody
상품 한눈에 보기
사람 AKR1B10 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등에 적합하며 RNA-seq 기반 Orthogonal 검증 완료. 고순도 Affinity 정제 및 안정한 보관용 완충액 구성.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA020280-100 Anti-AKR1B10 Antibody, aldo-keto reductase family 1, member B10 (aldose reductase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020280-25 Anti-AKR1B10 Antibody, aldo-keto reductase family 1, member B10 (aldose reductase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AKR1B10 Antibody
Anti-AKR1B10 Antibody
Target: aldo-keto reductase family 1, member B10 (aldose reductase)
Type: Polyclonal Antibody against Human AKR1B10
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Orthogonal Validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. - ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against human AKR1B10 protein.
Alternative Gene Names
AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | aldo-keto reductase family 1, member B10 (aldose reductase) |
| Target Gene | AKR1B10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000009734 (68%), Mouse ENSMUSG00000061758 (63%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



