CacheBy
Atlas Antibodies Anti-AKR1A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AKR1A1 Antibody

상품 한눈에 보기

Human AKR1A1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 고순도 IgG 형태로 제공됩니다. 인간에 대해 검증된 반응성을 가지며, 최적 사용 조건은 실험자가 결정합니다.

카탈로그번호
HPA017919-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017919-100 Anti-AKR1A1 Antibody, aldo-keto reductase family 1, member A1 (aldehyde reductase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017919-25 Anti-AKR1A1 Antibody, aldo-keto reductase family 1, member A1 (aldehyde reductase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AKR1A1 Antibody

Anti-AKR1A1 Antibody

Target Information

  • Target Protein: aldo-keto reductase family 1, member A1 (aldehyde reductase)
  • Target Gene: AKR1A1
  • Alternative Gene Names: ALR, DD3

Product Description

Polyclonal Antibody against Human AKR1A1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

KYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMH

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000016727 93%
Mouse ENSMUSG00000028692 91%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.