
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AK9 Antibody
상품 한눈에 보기
Human AK9 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현의 일관성을 검증하였습니다. PrEST 항원으로 정제된 고품질 항체입니다.
- 카탈로그번호
- HPA030805-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030805-100 Anti-AK9 Antibody, adenylate kinase 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030805-25 Anti-AK9 Antibody, adenylate kinase 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AK9 Antibody
Anti-AK9 Antibody
Target: adenylate kinase 9 (AK9)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Orthogonal validation:
Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human AK9 protein.
Alternative Gene Names
AKD1, AKD2, C6orf199, C6orf224, dJ70A9.1, FLJ25791, FLJ42177, MGC26954
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | adenylate kinase 9 |
| Target Gene | AK9 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKLQGAEEEINDTMENDELFRTLASYKLIAPRYRWQRSKWG |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000091415 (73%), Rat ENSRNOG00000037688 (72%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



