Atlas Antibodies Anti-LTB4R Antibody

상품 한눈에 보기

인간 LTB4R에 특이적인 폴리클로날 항체로, IHC 및 WB에 적합합니다. 재조합 발현 단백질로 검증되었으며, 토끼에서 생산된 IgG 형식입니다. 고순도 친화 정제 방식으로 제조되어 높은 특이성과 안정성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA003873-100 Anti-LTB4R Antibody, leukotriene B4 receptor 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA003873-25 Anti-LTB4R Antibody, leukotriene B4 receptor 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Leukotriene B4 receptor
Supplier: Atlas Antibodies

Recombinant expression validation:
Validated in WB using target protein overexpression.

Polyclonal antibody against human LTB4R.

BLTR, CMKRL1, GPR16, LTB4R1, P2RY7, P2Y7

항목	내용
Target Protein	Leukotriene B4 receptor
Target Gene	LTB4R
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	GVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNE
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000046908 (61%), Rat ENSRNOG00000020399 (60%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand