Atlas Antibodies Anti-LSS Antibody

상품 한눈에 보기

Human LSS 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 WB에 적합하며, PrEST 항원으로 친화 정제되었습니다. 인간 특이적 반응성을 검증받았으며, 안정적인 PBS/glycerol buffer에 보존됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA032060-100 Anti-LSS Antibody, lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA032060-25 Anti-LSS Antibody, lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human LSS.

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
IQALLEAGGHHRPEFSSCLQKAHEFLRLSQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVEC

Verified Species: Human
Interspecies Identity:
- Mouse (ENSMUSG00000033105): 87%
- Rat (ENSRNOG00000054549): 86%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage	Gently mix before use. Optimal concentrations and conditions should be determined by the user.