
원본
Atlas Antibodies Anti-LSM5 Antibody
상품 한눈에 보기
Human LSM5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합. 재조합 단백질 발현으로 검증됨. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA019054-100 Anti-LSM5 Antibody, LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019054-25 Anti-LSM5 Antibody, LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LSM5 Antibody
Anti-LSM5 Antibody
LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody against Human LSM5.
Alternative Gene Names
- YER146W
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) |
| Target Gene | LSM5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLV |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (100%), Rat (100%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



