Atlas Antibodies Anti-LSG1 Antibody

상품 한눈에 보기

Human LSG1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 사람, 마우스, 랫트에 반응합니다. 40% 글리세롤 기반 버퍼에 보존되어 안정적입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA037705-100 Anti-LSG1 Antibody, large 60S subunit nuclear export GTPase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037705-25 Anti-LSG1 Antibody, large 60S subunit nuclear export GTPase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: large 60S subunit nuclear export GTPase 1

IHC (Immunohistochemistry)
WB (Western Blot) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein
ICC (Immunocytochemistry)

Polyclonal antibody against Human LSG1.

항목	내용
Target Protein	large 60S subunit nuclear export GTPase 1
Target Gene	LSG1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	SELNDGYDWGRLNLQSVTEQSSLDDFLATAELAGTEFVAEKLNIKFVPAEARTGLLSFEESQRIKKLHEENKQFLCIPRRPNWNQNTTPEE