CacheBy
Atlas Antibodies Anti-AHR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AHR Antibody

상품 한눈에 보기

Human AHR(aryl hydrocarbon receptor)를 인식하는 rabbit polyclonal antibody. IHC 및 ICC에 추천. PrEST 항원을 이용한 affinity purification. 높은 특이성과 재현성을 제공. Human에 대해 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029723-100 Anti-AHR Antibody, aryl hydrocarbon receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029723-25 Anti-AHR Antibody, aryl hydrocarbon receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AHR Antibody

Anti-AHR Antibody

Target Information

  • Target Protein: aryl hydrocarbon receptor
  • Target Gene: AHR
  • Alternative Gene Names: bHLHe76

Product Description

Polyclonal antibody against human AHR.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
NWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLYSIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEI

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000004342 (65%)
  • Mouse ENSMUSG00000019256 (64%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

IHC Recommended
ICC Recommended

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.