CacheBy
Atlas Antibodies Anti-AHI1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AHI1 Antibody

상품 한눈에 보기

Human AHI1 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합함. PrEST 항원으로 친화 정제되었으며, 높은 종간 반응성(인간, 생쥐, 랫트)을 보임. 안정적인 PBS/glycerol 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA046684-100 Anti-AHI1 Antibody, Abelson helper integration site 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046684-25 Anti-AHI1 Antibody, Abelson helper integration site 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AHI1 Antibody

Anti-AHI1 Antibody

Target Information

  • Target Protein: Abelson helper integration site 1
  • Target Gene: AHI1
  • Alternative Gene Names: FLJ20069, JBTS3, ORF1

Product Description

Polyclonal antibody against Human AHI1.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QVAMYSDLPFKSPIRDISYHPFENMVAFCAFGQNEPILLYIYDFHVAQQEAEMFKRYNGTFPLPGIHQSQDALCTCPKLPHQGSFQIDEFVHTESSSTKMQLVKQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000019986): 88%
  • Rat (ENSRNOG00000013969): 87%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Recommended Applications Immunocytochemistry (ICC)
Datasheet Open Datasheet (PDF)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.