CacheBy
Atlas Antibodies Anti-LRRC61 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRC61 Antibody

상품 한눈에 보기

인간 LRRC61 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 단백질 기반으로 검증되었으며, 토끼 유래 IgG 형태로 높은 특이성과 재현성을 제공합니다. 친화 정제 방식으로 제조되어 안정적인 실험 결과를 보장합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019355-100 Anti-LRRC61 Antibody, leucine rich repeat containing 61 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019355-25 Anti-LRRC61 Antibody, leucine rich repeat containing 61 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRC61 Antibody

Anti-LRRC61 Antibody

Target: leucine rich repeat containing 61
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)
  • ICC (Immunocytochemistry)

Recombinant expression validation:
Validated in WB using target protein overexpression.


Product Description

Polyclonal antibody against human LRRC61.


Alternative Gene Names

FLJ31392, HSPC295, MGC3036

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein leucine rich repeat containing 61
Target Gene LRRC61
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000008234 (90%), Mouse ENSMUSG00000073096 (89%)

Antigen Sequence:

ATCENLQSLNAAGNLLATPGQLQCLAGLPCLEYLRLRDPLARLSNPLCANPSYWAAVRELLPGLKVIDGERV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.