Atlas Antibodies Anti-AGR2 Antibody

상품 한눈에 보기

Human AGR2 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터 기반 Orthogonal Validation 수행. Affinity purification으로 높은 특이성과 재현성 보장. 40% glycerol buffer에 보존.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA007912-100 Anti-AGR2 Antibody, anterior gradient 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA007912-25 Anti-AGR2 Antibody, anterior gradient 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-AGR2 Antibody

Anti-AGR2 Antibody

Target: anterior gradient 2 (AGR2)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
WB (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in high and low expression cell lines.
ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human AGR2.

Alternative Gene Names

AG2, HAG-2, PDIA17, XAG-2

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	anterior gradient 2
Target Gene	AGR2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGR
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000020581 (94%), Rat ENSRNOG00000005023 (94%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.