CacheBy
Atlas Antibodies Anti-AGPS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AGPS Antibody

상품 한눈에 보기

인간 AGPS(alkylglycerone phosphate synthase)를 인식하는 토끼 유래 폴리클로날 항체. IHC 및 ICC에 적합하며, PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 40% 글리세롤 PBS 버퍼에 보존제로 나트륨 아지드 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA030211-100 Anti-AGPS Antibody, alkylglycerone phosphate synthase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030211-25 Anti-AGPS Antibody, alkylglycerone phosphate synthase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AGPS Antibody

Anti-AGPS Antibody

Target Information

  • Target Protein: alkylglycerone phosphate synthase
  • Target Gene: AGPS
  • Alternative Gene Names: ADAP-S, ADAS, ADHAPS, ADPS, ALDHPSY
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human AGPS.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
QIELTGKRYPLSGMGLPTFKEWIQNTLGVNVEHKTTSKASLNPSDTPPSVVNEDFLHDLKETNISYSQEADDRVFRAHGHCLH

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000001547 81%
Mouse ENSMUSG00000042410 80%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.