AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRRC4C Antibody
상품 한눈에 보기
인간 LRRC4C 단백질을 인식하는 폴리클로날 항체. 면역세포화학(ICC) 등 다양한 연구 응용에 적합. 토끼에서 생산된 IgG 형식으로, PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, 마우스 및 랫과 100% 서열 동일성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA054800-100 Anti-LRRC4C Antibody, leucine rich repeat containing 4C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054800-25 Anti-LRRC4C Antibody, leucine rich repeat containing 4C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRRC4C Antibody
Anti-LRRC4C Antibody
Target Information
- Target Protein: Leucine rich repeat containing 4C
- Target Gene: LRRC4C
- Alternative Gene Names: KIAA1580, NGL-1
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human LRRC4C.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
NVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKD
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000050587): 100%
- Rat (ENSRNOG00000029798): 100%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Preservative MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.