CacheBy
Atlas Antibodies Anti-AGMAT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AGMAT Antibody

상품 한눈에 보기

Human AGMAT 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 정량적 단백질 발현 검증에 적합. 토끼에서 생산된 IgG 항체이며, 고순도 Affinity 정제 방식 적용. RNA-seq 데이터 기반 Orthogonal 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026443-100 Anti-AGMAT Antibody, agmatine ureohydrolase (agmatinase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026443-25 Anti-AGMAT Antibody, agmatine ureohydrolase (agmatinase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AGMAT Antibody

Anti-AGMAT Antibody

agmatine ureohydrolase (agmatinase)


  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB (Western Blot)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human AGMAT


Alternative Gene Names

  • FLJ23384

Open Datasheet


Target Information

항목 내용
Target Protein agmatine ureohydrolase (agmatinase)
Target Gene AGMAT
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
MLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHG
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000012315 (80%)
Mouse ENSMUSG00000040706 (79%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.