CacheBy
Atlas Antibodies Anti-AGMAT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AGMAT Antibody

상품 한눈에 보기

Human AGMAT 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 정량적 단백질 발현 검증에 적합. 토끼에서 생산된 IgG 항체이며, 고순도 Affinity 정제 방식 적용. RNA-seq 데이터 기반 Orthogonal 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA026443-100 Anti-AGMAT Antibody, agmatine ureohydrolase (agmatinase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026443-25 Anti-AGMAT Antibody, agmatine ureohydrolase (agmatinase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AGMAT Antibody

Anti-AGMAT Antibody

agmatine ureohydrolase (agmatinase)


  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB (Western Blot)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human AGMAT


Alternative Gene Names

  • FLJ23384

Open Datasheet


Target Information

항목 내용
Target Protein agmatine ureohydrolase (agmatinase)
Target Gene AGMAT
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
MLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHG
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000012315 (80%)
Mouse ENSMUSG00000040706 (79%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.