CacheBy
Atlas Antibodies Anti-AGAP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AGAP2 Antibody

상품 한눈에 보기

인간 AGAP2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 토끼 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 쥐와 생쥐와도 높은 서열 유사성을 가집니다.

카탈로그번호
HPA075831-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA075831-100 Anti-AGAP2 Antibody, ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075831-25 Anti-AGAP2 Antibody, ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AGAP2 Antibody

Anti-AGAP2 Antibody

ArfGAP with GTPase domain, ankyrin repeat and PH domain 2

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human AGAP2.

Alternative Gene Names

  • CENTG1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
Target Gene AGAP2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTE

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000025584 95%
Mouse ENSMUSG00000025422 95%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.