CacheBy
Atlas Antibodies Anti-LRRC30 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRC30 Antibody

상품 한눈에 보기

Human LRRC30 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 재현성을 제공합니다. PBS와 글리세롤 기반 버퍼에 보존제가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041039-100 Anti-LRRC30 Antibody, leucine rich repeat containing 30 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041039-25 Anti-LRRC30 Antibody, leucine rich repeat containing 30 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRC30 Antibody

Anti-LRRC30 Antibody

Target: leucine rich repeat containing 30 (LRRC30)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human LRRC30.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein leucine rich repeat containing 30
Target Gene LRRC30
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence HNQLRVLPPEVGKLTRIVVLNLCGNRLKSLPREVSLLQCLKVLFVSMNCLTEVPAELSLCRKLEVLSLSHNCLSQ

Species Reactivity

항목 내용
Verified Species Reactivity Human
Ortholog Identity Mouse ENSMUSG00000073375 (89%)
Rat ENSRNOG00000030389 (88%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.