CacheBy
Atlas Antibodies Anti-LRRC28 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRC28 Antibody

상품 한눈에 보기

Human LRRC28 단백질을 인식하는 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. PBS/glycerol buffer에 보존제로 sodium azide 포함.

카탈로그번호
HPA040784-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040784-100 Anti-LRRC28 Antibody, leucine rich repeat containing 28 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040784-25 Anti-LRRC28 Antibody, leucine rich repeat containing 28 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRC28 Antibody

Anti-LRRC28 Antibody

Target: leucine rich repeat containing 28 (LRRC28)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human LRRC28.


Alternative Gene Names

FLJ34269, FLJ45242, MGC24976

Open Datasheet


Target Information

항목 내용
Target Protein Leucine rich repeat containing 28
Target Gene LRRC28
Verified Species Reactivity Human
Interspecies Identity Mouse (83%), Rat (81%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NIHLKGLPSYLYNKVIGCSGCGAPIQVSEVKLLSFSSGQRTVFLPAEVKAIGTEHDHVLPLQELAMRGLYHTYHSLLKDLNFL

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.