CacheBy
Atlas Antibodies Anti-AGAP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AGAP3 Antibody

상품 한눈에 보기

Human AGAP3 단백질을 인식하는 토끼 폴리클로날 항체로, ArfGAP with GTPase domain, ankyrin repeat, PH domain 3을 타겟으로 함. IHC 등 다양한 응용에 적합하며, 친화 정제된 고품질 항체.

카탈로그번호
HPA012883-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012883-100 Anti-AGAP3 Antibody, ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012883-25 Anti-AGAP3 Antibody, ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AGAP3 Antibody

Anti-AGAP3 Antibody

Target: ArfGAP with GTPase domain, ankyrin repeat and PH domain 3
Supplier: Atlas Antibodies
Catalog: HPA012883


Product Description

Polyclonal antibody against human AGAP3, also known as CENTG3.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)


Immunohistochemistry (IHC)


Target Information

항목 내용
Target Protein ArfGAP with GTPase domain, ankyrin repeat and PH domain 3
Target Gene AGAP3
Alternative Gene Names CENTG3

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGCPGEGCGLAPTPNREPANGTNPSAE

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000012764 (100%)
  • Mouse ENSMUSG00000023353 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.