Atlas Antibodies Anti-LRRC27 Antibody

상품 한눈에 보기

인간 LRRC27 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 실험에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Rabbit 호스트 기반 IgG 형식이며, 인체 반응성이 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA067395-100 Anti-LRRC27 Antibody, leucine rich repeat containing 27 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA067395-25 Anti-LRRC27 Antibody, leucine rich repeat containing 27 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: leucine rich repeat containing 27
Product Type: Polyclonal Antibody against Human LRRC27

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data from tissues with high and low target expression.
WB (Western Blot)

항목	내용
Target Gene	LRRC27
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	NRKVPLNPPGKMKPSKEKSPQASKEMSALQERNLEEKIKQHVLQMREQRRFHGQAPLEEMRKAAEDLEIATELQDEVLKLKLGL
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000111011 (42%), Rat ENSRNOG00000017538 (38%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.