CacheBy
Atlas Antibodies Anti-LRRC24 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRC24 Antibody

상품 한눈에 보기

Human LRRC24 단백질을 인식하는 토끼 폴리클로날 항체로, ICC 등 다양한 연구 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 고순도 IgG 형태로 제공. 인체 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028171-100 Anti-LRRC24 Antibody, leucine rich repeat containing 24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028171-25 Anti-LRRC24 Antibody, leucine rich repeat containing 24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRC24 Antibody

Anti-LRRC24 Antibody

Target: Leucine rich repeat containing 24 (LRRC24)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human LRRC24 protein.

  • Immunocytochemistry (ICC)

Alternative Gene Names

  • LRRC14OS

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Leucine rich repeat containing 24
Target Gene LRRC24
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EGALFVNDYLDGPCTFAQLEELRDERGHEMFVINRSKPLFAEGPAEAPADCGPEQGAGPGLRVPPPVAYEIHC

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000016204 70%
Mouse ENSMUSG00000033707 68%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.