CacheBy
Atlas Antibodies Anti-LRIT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRIT2 Antibody

상품 한눈에 보기

Human LRIT2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 연구용 응용에 적합합니다. PrEST 항원 기반으로 정제되어 높은 특이성과 재현성을 제공합니다. Human에 반응하며, Mouse 및 Rat과도 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037788-100 Anti-LRIT2 Antibody, leucine-rich repeat, immunoglobulin-like and transmembrane domains 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037788-25 Anti-LRIT2 Antibody, leucine-rich repeat, immunoglobulin-like and transmembrane domains 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRIT2 Antibody

Anti-LRIT2 Antibody

Target: Leucine-rich repeat, immunoglobulin-like and transmembrane domains 2 (LRIT2)
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.


Product Description

Polyclonal antibody against Human LRIT2.


Alternative Gene Names

  • AC022389.4
  • LRRC22

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Leucine-rich repeat, immunoglobulin-like and transmembrane domains 2
Target Gene LRIT2
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000022726 (74%), Mouse ENSMUSG00000043418 (72%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LVISLHVQPAQALHAPDSLSIPSEGNAYIDLRVVKQTVHGILLEWLAVADTSKEEWFTLYIASDEAFRKEVVHIGPGINTYAVDDLLPGTKYE

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.