CacheBy
Atlas Antibodies Anti-ADORA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADORA1 Antibody

상품 한눈에 보기

Human ADORA1(Adenosine A1 receptor)을 인식하는 rabbit polyclonal antibody. Affinity purification으로 높은 특이성과 안정성 제공. ICC 등 다양한 응용에 적합하며 glycerol/PBS buffer로 장기간 보존 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA044383-100 Anti-ADORA1 Antibody, adenosine A1 receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044383-25 Anti-ADORA1 Antibody, adenosine A1 receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADORA1 Antibody

Anti-ADORA1 Antibody

Target Information

  • Target Protein: Adenosine A1 receptor
  • Target Gene: ADORA1
  • Alternative Gene Names: RDC7

ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human ADORA1.
Affinity purified using the PrEST antigen as affinity ligand.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000042429): 89%
  • Rat (ENSRNOG00000003442): 87%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen
Storage Note Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Additional Resources

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.