
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ADORA1 Antibody
상품 한눈에 보기
Human ADORA1(Adenosine A1 receptor)을 인식하는 rabbit polyclonal antibody. Affinity purification으로 높은 특이성과 안정성 제공. ICC 등 다양한 응용에 적합하며 glycerol/PBS buffer로 장기간 보존 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044383-100 Anti-ADORA1 Antibody, adenosine A1 receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044383-25 Anti-ADORA1 Antibody, adenosine A1 receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ADORA1 Antibody
Anti-ADORA1 Antibody
Target Information
- Target Protein: Adenosine A1 receptor
- Target Gene: ADORA1
- Alternative Gene Names: RDC7
Recommended Applications
ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human ADORA1.
Affinity purified using the PrEST antigen as affinity ligand.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000042429): 89%
- Rat (ENSRNOG00000003442): 87%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Note | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



