Atlas Antibodies Anti-ADORA1 Antibody

상품 한눈에 보기

Human ADORA1(Adenosine A1 receptor)을 인식하는 rabbit polyclonal antibody. Affinity purification으로 높은 특이성과 안정성 제공. ICC 등 다양한 응용에 적합하며 glycerol/PBS buffer로 장기간 보존 가능.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044383-100 Anti-ADORA1 Antibody, adenosine A1 receptor 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044383-25 Anti-ADORA1 Antibody, adenosine A1 receptor 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ADORA1 Antibody

Anti-ADORA1 Antibody

Target Information

Target Protein: Adenosine A1 receptor
Target Gene: ADORA1
Alternative Gene Names: RDC7

Recommended Applications

ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human ADORA1.
Affinity purified using the PrEST antigen as affinity ligand.

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse (ENSMUSG00000042429): 89%
Rat (ENSRNOG00000003442): 87%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Storage Note	Gently mix before use. Optimal concentrations and conditions should be determined by the user.