CacheBy
Atlas Antibodies Anti-ADH7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADH7 Antibody

상품 한눈에 보기

인간 ADH7 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. Rabbit 유래 IgG이며 PrEST 항원으로 친화 정제되었습니다. Human, Mouse, Rat 반응성 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039695-100 Anti-ADH7 Antibody, alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039695-25 Anti-ADH7 Antibody, alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADH7 Antibody

Anti-ADH7 Antibody

Target Protein: alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
Alternative Gene Names: ADH-4
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against human ADH7.


Target Information

항목 내용
Target Protein alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
Target Gene ADH7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000055301 (86%), Rat ENSRNOG00000032959 (81%)

Antigen Sequence:

KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.