Atlas Antibodies Anti-ADH7 Antibody

상품 한눈에 보기

인간 ADH7 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. Rabbit 유래 IgG이며 PrEST 항원으로 친화 정제되었습니다. Human, Mouse, Rat 반응성 확인됨.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039695-100 Anti-ADH7 Antibody, alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039695-25 Anti-ADH7 Antibody, alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ADH7 Antibody

Anti-ADH7 Antibody

Target Protein: alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
Alternative Gene Names: ADH-4
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)

Product Description

Polyclonal antibody against human ADH7.

Target Information

항목	내용
Target Protein	alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
Target Gene	ADH7
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Mouse ENSMUSG00000055301 (86%), Rat ENSRNOG00000032959 (81%)

Antigen Sequence:

KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand