CacheBy
Atlas Antibodies Anti-LPIN3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LPIN3 Antibody

상품 한눈에 보기

Human LPIN3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, 고순도 Affinity 정제 방식으로 제조됨. Human에 반응 확인됨. 안정적인 PBS/glycerol buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052667-100 Anti-LPIN3 Antibody, lipin 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052667-25 Anti-LPIN3 Antibody, lipin 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LPIN3 Antibody

Anti-LPIN3 Antibody

Target Information

  • Target Protein: lipin 3
  • Target Gene: LPIN3
  • Alternative Gene Names: LIPN3L, SMP2

Product Description

Polyclonal antibody against Human LPIN3.

면역조직화학(IHC) 등 다양한 생물학적 분석에 적합.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FFVQELESDDEHVPPGLCTSPIPWGGLSGFPSDSQLGTASEPEGLVMAGTASTGRRKRRRRRKPKQKEDAVATDSSP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000016636 (75%)
  • Mouse ENSMUSG00000027412 (73%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Additional Information

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.