원본
Atlas Antibodies Anti-LPAR6 Antibody
상품 한눈에 보기
Human LPAR6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. P2RY5(P2Y5)로도 알려진 LPAR6 단백질을 특이적으로 검출. 친화 정제된 고품질 항체로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028934-100 Anti-LPAR6 Antibody, lysophosphatidic acid receptor 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028934-25 Anti-LPAR6 Antibody, lysophosphatidic acid receptor 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LPAR6 Antibody
Anti-LPAR6 Antibody
Target: Lysophosphatidic acid receptor 6 (LPAR6)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human LPAR6 (lysophosphatidic acid receptor 6).
Alternative Gene Names
- P2RY5
- P2Y5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Lysophosphatidic acid receptor 6 |
| Target Gene | LPAR6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESA |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000033446 | 89% |
| Rat | ENSRNOG00000015577 | 87% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.