Atlas Antibodies Anti-LOX Antibody

상품 한눈에 보기

인간 LOX(lysyl oxidase)를 인식하는 폴리클로날 항체로, 토끼에서 생산된 IgG 형식입니다. PrEST 항원으로 정제되었으며, 인간에 대해 검증된 반응성을 가집니다. 면역형광 및 단백질 발현 연구에 적합합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA043930-100 Anti-LOX Antibody, lysyl oxidase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA043930-25 Anti-LOX Antibody, lysyl oxidase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Lysyl oxidase
Target Gene: LOX
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
VGDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRC

Human

Highest antigen sequence identity to orthologs:

Polyclonal Antibody against Human LOX

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Preservative	Sodium azide (0.02%)
Storage Note	Gently mix before use. Optimal concentrations and conditions should be determined by the user.