CacheBy
Atlas Antibodies Anti-LONRF3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LONRF3 Antibody

상품 한눈에 보기

인간 LONRF3 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산된 IgG 형태입니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 기반 PBS 완충액에 보존됩니다. 인간 시료에 검증되었으며, 다양한 응용에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050422-100 Anti-LONRF3 Antibody, LON peptidase N-terminal domain and ring finger 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050422-25 Anti-LONRF3 Antibody, LON peptidase N-terminal domain and ring finger 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LONRF3 Antibody

Anti-LONRF3 Antibody

LON peptidase N-terminal domain and ring finger 3

면역세포화학(ICC) 등 다양한 응용에 사용 가능

Product Description

Polyclonal Antibody against Human LONRF3

Alternative Gene Names

FLJ22612, RNF127

Open Datasheet (PDF)

Target Information

  • Target Protein: LON peptidase N-terminal domain and ring finger 3
  • Target Gene: LONRF3

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LMDPAKVKGDGQQHHMKDQEEEEEKWDATSPKAASSKTGKCQEKKRKHCQIESQEETGMPNKASKQDPPTDQGDKPALSLPLASFDASDL

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000013092 (56%)
  • Mouse ENSMUSG00000016239 (56%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.