CacheBy
Atlas Antibodies Anti-LONRF2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LONRF2 Antibody

상품 한눈에 보기

Human LONRF2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 ICC에 적합하며, PrEST 항원으로 친화 정제됨. 40% glycerol 기반 PBS 버퍼에 sodium azide 보존제가 포함됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057366-100 Anti-LONRF2 Antibody, LON peptidase N-terminal domain and ring finger 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057366-25 Anti-LONRF2 Antibody, LON peptidase N-terminal domain and ring finger 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LONRF2 Antibody

Anti-LONRF2 Antibody

Target: LON peptidase N-terminal domain and ring finger 2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human LONRF2.


Alternative Gene Names

  • FLJ45273
  • RNF192

Open Datasheet


Target Information

항목 내용
Target Protein LON peptidase N-terminal domain and ring finger 2
Target Gene LONRF2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (82%), Mouse (56%)

Antigen Sequence:
LAPDDNSLLLLRAELYLTMKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYC


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.