CacheBy
Atlas Antibodies Anti-LMTK3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LMTK3 Antibody

상품 한눈에 보기

인간 LMTK3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합. 고순도 PrEST 항원 친화 정제 방식으로 제조. 인간 및 생쥐 반응성이 검증됨. 안정한 PBS/glycerol 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077070-100 Anti-LMTK3 Antibody, lemur tyrosine kinase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077070-25 Anti-LMTK3 Antibody, lemur tyrosine kinase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LMTK3 Antibody

Anti-LMTK3 Antibody

Target Protein: Lemur Tyrosine Kinase 3 (LMTK3)
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against human LMTK3.

Alternative Gene Names

KIAA1883, LMR3, PPP1R101, TYKLM3

Open Datasheet

Target Information

  • Target Protein: Lemur Tyrosine Kinase 3
  • Target Gene: LMTK3
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope sequence:
CSCLPLERGDAVAGWGGHPALGCPHPPEDDSSLRAERGSLADLPMAPPASAPPEFLDP

Verified Species Reactivity

Human, Mouse

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000062044 (91%)
  • Rat ENSRNOG00000009687 (34%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

IHC (Immunohistochemistry)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.