CacheBy
Atlas Antibodies Anti-LLPH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LLPH Antibody

상품 한눈에 보기

인간 LLPH 단백질을 타겟으로 하는 폴리클로날 항체입니다. Rabbit에서 생산되었으며 IgG 아이소타입입니다. Affinity purification 방식으로 정제되었습니다. ICC 등 다양한 응용에 적합하며 Human에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058786-100 Anti-LLPH Antibody, LLP homolog, long-term synaptic facilitation (Aplysia) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058786-25 Anti-LLPH Antibody, LLP homolog, long-term synaptic facilitation (Aplysia) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LLPH Antibody

Anti-LLPH Antibody

LLP homolog, long-term synaptic facilitation (Aplysia)

면역세포화학 (ICC)

Product Description

Polyclonal Antibody against Human LLPH

Alternative Gene Names

C12orf31, hLLP, MGC14817

Open Datasheet

Target Information

항목 내용
Target Protein LLP homolog, long-term synaptic facilitation (Aplysia)
Target Gene LLPH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KMQCEVKDEKDDMKMETDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKG

Verified Species Reactivity

Human

Interspecies Information

Ortholog ID Antigen Sequence Identity
Rat ENSRNOG00000004316 81%
Mouse ENSMUSG00000020224 72%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적 농도와 조건은 사용자가 실험 목적에 따라 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.