AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LLPH Antibody
상품 한눈에 보기
인간 LLPH 단백질을 타겟으로 하는 폴리클로날 항체입니다. Rabbit에서 생산되었으며 IgG 아이소타입입니다. Affinity purification 방식으로 정제되었습니다. ICC 등 다양한 응용에 적합하며 Human에 대한 반응성이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058786-100 Anti-LLPH Antibody, LLP homolog, long-term synaptic facilitation (Aplysia) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058786-25 Anti-LLPH Antibody, LLP homolog, long-term synaptic facilitation (Aplysia) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LLPH Antibody
Anti-LLPH Antibody
LLP homolog, long-term synaptic facilitation (Aplysia)
Recommended Applications
면역세포화학 (ICC)
Product Description
Polyclonal Antibody against Human LLPH
Alternative Gene Names
C12orf31, hLLP, MGC14817
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | LLP homolog, long-term synaptic facilitation (Aplysia) |
| Target Gene | LLPH |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KMQCEVKDEKDDMKMETDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKG |
Verified Species Reactivity
Human
Interspecies Information
| 종 | Ortholog ID | Antigen Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000004316 | 81% |
| Mouse | ENSMUSG00000020224 | 72% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적 농도와 조건은 사용자가 실험 목적에 따라 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.