CacheBy
Atlas Antibodies Anti-LIPA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LIPA Antibody

상품 한눈에 보기

인체 LIPA 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 사람에서 검증되었으며 CESD, LAL 유전자 대체명으로도 알려져 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057052-100 Anti-LIPA Antibody, lipase A, lysosomal acid, cholesterol esterase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057052-25 Anti-LIPA Antibody, lipase A, lysosomal acid, cholesterol esterase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LIPA Antibody

Anti-LIPA Antibody

Target Protein: lipase A, lysosomal acid, cholesterol esterase
Alternative Gene Names: CESD, LAL

  • Immunohistochemistry (IHC) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human LIPA

Target Information

항목 내용
Target Gene LIPA
Target Protein lipase A, lysosomal acid, cholesterol esterase
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000019077 (64%), Mouse ENSMUSG00000024771 (56%)

Antigen Sequence:
FALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEF

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.